Keyword research for spanking on tumblr

Add to Dashboard Remove

Keyword Popularity

10 out of 1000

Competition Index

10 out of 1000

Keyword Advertise Index

10 out of 1000

The best relevant websites by spanking on tumblr

Position	Website	Change	Thumbnail
1	spankinkandsubmission.tumblr - Submission Spanking and really cute chicks This space, as spanking it self, is for adults only (18 years or older), minors GTFOH. The pictures here displayed are taken from the internet and thu...	0
2	fuckyeahspanking.tumblr - Spanking #777	-1
3	otkspnk.tumblr - Spanking Hello, just a spanking blog. I like domestic style spankings both erotic and punishment. I dont like it when they are overly rigid I think it should b...	-3
4	overmyknee.tumblr - Over My Knee, Young Lady! This is all about spanking - and spanking is for adults only! For more spanking related stuff visit the Chross Blog	0
5	spankym41.tumblr - FM OTK SPANKINGS This is all about Spankings, Nylons and Feet those are my fetishes in that order	0
6	strictlyspanking.tumblr - Strictly Spanking	0
7	spanked2tears.tumblr - Who's Sorry Now? A "REAL SPANKING" only truly begins, well after the recipient is desperate for it to end...	0
8	victorianspanking.tumblr - A Libertine's Spanking. I'm a woman. I'm a feminist. I love to be spanked.	-7
9	hardhandsworld.tumblr - Hardhands World of Spanking All images taken from the Internet and assumed to be in the public domain, unless otherwise noted. If you believe an image infringes your rights in an...	0
10	myspankingaunt.tumblr - My Spanking Aunt	0
11	littlemissspankypantsarchive.tumblr - Little Miss Spanky Pants Archive A collection of photos & videos from the defunct Little Miss Spankypants Tumblr. Original Description: "a good little girlfriend who sometime...	0
12	spankingamateur.tumblr - Amateur spankings Early 40?s french gentleman, always passionate about spanking, caning, cp, domestic discipline and naughty french maids....living in Belgium and trave...	0

Generated on 2012-07-24

Related keywords by spanking on tumblr

Most Traffic by spanking on tumblr

Social activity by spanking on tumblr