Keyword research for spanking on tumblr

Keyword Popularity

10 out of 1000

Competition Index

10 out of 1000

Keyword Advertise Index

10 out of 1000

The best relevant websites by spanking on tumblr

Position Website Change Thumbnail
1 spankinkandsubmission.tumblr - Submission Spanking and really cute chicks
This space, as spanking it self, is for adults only (18 years or older), minors GTFOH. The pictures here displayed are taken from the internet and thu...
thumbnail of the spankinkandsubmission.tumblr.com
2 fuckyeahspanking.tumblr - Spanking
#777
-1  thumbnail of the fuckyeahspanking.tumblr.com
3 otkspnk.tumblr - Spanking
Hello, just a spanking blog. I like domestic style spankings both erotic and punishment. I dont like it when they are overly rigid I think it should b...
-3  thumbnail of the otkspnk.tumblr.com
4 overmyknee.tumblr - Over My Knee, Young Lady!
This is all about spanking - and spanking is for adults only! For more spanking related stuff visit the Chross Blog
thumbnail of the overmyknee.tumblr.com
5 spankym41.tumblr - FM OTK SPANKINGS
This is all about Spankings, Nylons and Feet those are my fetishes in that order
thumbnail of the spankym41.tumblr.com
6 strictlyspanking.tumblr - Strictly Spanking
thumbnail of the strictlyspanking.tumblr.com
7 spanked2tears.tumblr - Who's Sorry Now?
A "REAL SPANKING" only truly begins, well after the recipient is desperate for it to end...
thumbnail of the spanked2tears.tumblr.com
8 victorianspanking.tumblr - A Libertine's Spanking.
I'm a woman. I'm a feminist. I love to be spanked.
-7  thumbnail of the victorianspanking.tumblr.com
9 hardhandsworld.tumblr - Hardhands World of Spanking
All images taken from the Internet and assumed to be in the public domain, unless otherwise noted. If you believe an image infringes your rights in an...
thumbnail of the hardhandsworld.tumblr.com
10 myspankingaunt.tumblr - My Spanking Aunt
thumbnail of the myspankingaunt.tumblr.com
11 littlemissspankypantsarchive.tumblr - Little Miss Spanky Pants Archive
A collection of photos & videos from the defunct Little Miss Spankypants Tumblr. Original Description: "a good little girlfriend who sometime...
thumbnail of the littlemissspankypantsarchive.tumblr.com
12 spankingamateur.tumblr - Amateur spankings
Early 40?s french gentleman, always passionate about spanking, caning, cp, domestic discipline and naughty french maids....living in Belgium and trave...
thumbnail of the spankingamateur.tumblr.com
Generated on 2012-07-24

Related keywords by spanking on tumblr

I have no idea. Please, refresh tomorrow ;)

Most Traffic by spanking on tumblr

Sorry. Not enough data. Please, refresh tomorrow ;) Thank you!

Social activity by spanking on tumblr

Twitter activity